PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10014837
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 273aa    MW: 30676 Da    PI: 6.8953
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10014837genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.71.2e-072166345
                     SS-HHHHHHHHHHHHHTTTT....-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg....tWktIartmgkgRtlkqcksrwq 45
                      WT eE + +  a + +G +    +W ++a++++ g++  +++  + 
      Lus10014837 21 YWTREENKAFESALAIYGDEhdpdRWFKVAAMIP-GKSVSDVIKQYM 66
                     5*****************99**************.****99998876 PP

2Myb_DNA-binding43.38.3e-14125169347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT++E+ +++++  ++G+g+W+ I+r +   +t+ q+ s+ qky
      Lus10014837 125 PWTEDEHRRFLKGLMKYGKGDWRNISRNFVVSKTPTQVASHAQKY 169
                      8*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512939.6341773IPR017884SANT domain
SMARTSM007173.5E-81871IPR001005SANT/Myb domain
SuperFamilySSF466892.32E-92073IPR009057Homeodomain-like
PfamPF002491.2E-62166IPR001005SANT/Myb domain
CDDcd001678.55E-82268No hitNo description
PROSITE profilePS5129419.034117174IPR017930Myb domain
SuperFamilySSF466894.34E-16119174IPR009057Homeodomain-like
TIGRFAMsTIGR015575.8E-19121173IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.604.7E-11122168IPR009057Homeodomain-like
SMARTSM007179.9E-12122172IPR001005SANT/Myb domain
CDDcd001671.51E-9125170No hitNo description
PfamPF002493.0E-11125169IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MEAAVYEHFY MPQNDDVGSE YWTREENKAF ESALAIYGDE HDPDRWFKVA AMIPGKSVSD  60
VIKQYMELEE DVGEIEAGRV PLPGYFPGGD EDDCSSFTLE LIDSFRKRPL GSTKTSDQGR  120
KKGVPWTEDE HRRFLKGLMK YGKGDWRNIS RNFVVSKTPT QVASHAQKYF IRQQLSGVKD  180
KRRPSIHDIT TVNLSSLDSS SAAANELSGL FSSPAVAYKY NNKASWNYQH STTTSSSPSS  240
NSLFMVASSS PYNNYYDHIA AFQTSNARRI RG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A2e-1322891177RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002530418.11e-93PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H72e-71DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLB9SWP92e-93B9SWP9_RICCO; DNA binding protein, putative
STRINGPOPTR_0010s20040.11e-90(Populus trichocarpa)
STRINGGLYMA14G06750.12e-90(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46634162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11280.22e-79MYB family protein